CJC-1295 NO DAC, also called Mod GRF(1-29), is a short-acting GHRH analog. Unlike the DAC version, it does not incorporate the complex that extends half-life. It is studied in growth axis research. NeoPeptidos offers it with ≥99% HPLC purity, for research use.
Technical profile
| Product | CJC-1295 NO DAC |
|---|---|
| CAS | 863288-34-0 |
| Molecular formula | C₁₅₂H₂₅₂N₄₄O₄₂ |
| Molecular weight | 3367.97 Da |
| Sequence | Y(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH₂ (29 aa modificado) |
| Purity | 99% HPLC |
| Presentation | Lyophilized vial; bacteriostatic water included |
| Use | For scientific research use only |
What is CJC-1295 NO DAC?
It corresponds to a modified, stabilized fraction of GHRH. Because it lacks the Drug Affinity Complex, its action is short, which makes it useful for studying more defined pulses of growth hormone release.
Research context
Research with CJC-1295 NO DAC focuses on the GHRH–GH axis and on comparison with long-acting analogs in experimental models.
The NeoPeptidos product is research-grade material; it includes no indications or administration schedules and is intended exclusively for researchers.
Handling and reconstitution
See the reconstitution guide and the storage guide.
Quality and traceability
≥99% purity by HPLC and batch COA. See quality control.
🔬 Updated on September 27, 2026 · Reviewed by the NeoPeptidos team · Content for research purposes (RUO).