VIP stands for vasoactive intestinal peptide, a 28-amino-acid neuropeptide with very diverse functions, which is why it is described as pleiotropic. It is studied in immuno-neuroendocrine research. NeoPeptidos offers it with ≥99% HPLC purity, for research use.
Technical profile
| Product | VIP |
|---|---|
| CAS | 37221-79-7 |
| Molecular formula | C₁₄₇H₂₃₇N₄₃O₄₃S |
| Molecular weight | 3326.79 Da |
| Sequence | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂ (28 aa) |
| Purity | 99% HPLC |
| Presentation | Lyophilized vial; bacteriostatic water included |
| Use | For scientific research use only |
What is VIP?
VIP is found in the nervous and digestive systems and acts on multiple tissues. In the literature it is associated with vascular regulation, immune modulation and biological rhythms, which makes it a study tool in several fields at once.
Research context
Research on VIP covers the modulation of inflammation, vascular function and neuroendocrine signaling in cellular and preclinical models.
The NeoPeptidos product is research-grade material; it includes no indications or administration schedules and is intended exclusively for researchers.
Handling and reconstitution
See the reconstitution guide and the storage guide.
Quality and traceability
≥99% purity by HPLC and batch COA. See quality control.
🔬 Updated on September 27, 2026 · Reviewed by the NeoPeptidos team · Content for research purposes (RUO).