LL-37 is the only antimicrobial peptide of the cathelicidin family present in humans. It is part of the innate immune system and is studied in research on antimicrobial defense and immunity. NeoPeptidos offers it with ≥99% HPLC purity, for research use.
Technical profile
| Product | LL-37 |
|---|---|
| CAS | 154947-66-7 |
| Molecular formula | C₂₀₅H₃₄₀N₆₀O₅₃ |
| Molecular weight | 4493.33 Da |
| Sequence | [LL-37, 37 aa] (37 aa) |
| Purity | 99% HPLC |
| Presentation | Lyophilized vial; bacteriostatic water included |
| Use | For scientific research use only |
What is LL-37?
LL-37 is a 37-amino-acid peptide (its name comes from its two initial leucines). Besides its direct action on microbial membranes, in the literature it is associated with modulation of the immune response, so it is studied as an antimicrobial and immunomodulatory peptide.
Research context
Research on LL-37 covers innate immunity, antimicrobial activity and the modulation of inflammation in cellular and preclinical models.
These findings belong to the field of research and do not constitute evidence of efficacy in humans. LL-37 is offered for research use only.
Handling and reconstitution
See the reconstitution guide and the storage guide.
Quality and traceability
≥99% purity by HPLC and batch COA. See quality control.
🔬 Updated on September 27, 2026 · Reviewed by the NeoPeptidos team · Content for research purposes (RUO).